The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Matrix protein 1 from influenza A virus A/crow/Kyoto/T1/2004(H5N1). To be Published
    Site RSGI
    PDB Id 2z16 Target Id ar_001000435.1
    Molecular Characteristics
    Source Influenza a virus
    Alias Ids TPS12157, Molecular Weight 17356.24 Da.
    Residues 158 Isoelectric Point 8.45
    Sequence mslltevetyvlsiipsgplkaeiaqkledvfagkntdlealmewlktrpilspltkgilgfvftltvp serglqrrrfvqnalngngdpnnmdravklykklkreitfhgakevalsystgalascmgliynrmgtv ttevafglvcatceqiadsq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.02 Rfree 0.23030
    Matthews' coefficent 1.89 Rfactor 0.20101
    Waters 124 Solvent Content 34.83

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch