.
The Open Protein Structure Annotation Network
PDB Keyword
.

2z17

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal sturcture of PDZ domain from human Pleckstrin homology, Sec7. To be Published
    Site RSGI
    PDB Id 2z17 Target Id hsk003000395.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12821, Molecular Weight 10776.47 Da.
    Residues 97 Isoelectric Point 4.61
    Sequence lsdfswsqrklvtvekqdnetfgfeiqsyrpqnqnacssemftlickiqedspahcaglqagdvlanin gvstegftykqvvdlirssgnlltietl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.70 Rfree 0.334
    Matthews' coefficent 2.25 Rfactor 0.244
    Waters 11 Solvent Content 45.32

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch