The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of 5-aminolevulinic acid dehydratase (ALAD) from Mus musculs. To be Published
    Site RSGI
    PDB Id 2z1b Target Id mmk001003090.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13435, Molecular Weight 36037.51 Da.
    Residues 330 Isoelectric Point 6.32
    Sequence mhhqsvlhsgyfhpllrswqtaastvsasnliypifvtdvpddvqpiaslpgvarygvnqleemlrplv eaglrcvlifgvpsrvpkdeqgsaadsedsptieavrllrktfpsllvacdvclcpytshghcgllsen gaflseesrqrlaevalayakagcqvvapsdmmdgrveaikaallkhglgnrvsvmsysakfascfygp frdaaqsspafgdrrcyqlppgarglalravardiqegadmlmvkpglpyldmvrevkdkhpelplavy qvsgefamlwhgaqagafdlrtavletmtafrragadiiityfapqllkwlkee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.30 Rfree 0.353
    Matthews' coefficent 3.02 Rfactor 0.278
    Waters 57 Solvent Content 59.23

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch