The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Ttha1563 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2z1k Target Id ttk003000385.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14357, Molecular Weight 53755.63 Da.
    Residues 475 Isoelectric Point 6.48
    Sequence mawyegaffyqifpdrffragppgrpapagpfepweapptlrgfkggtlwgvaeklpylldlgveaiyl npvfastanhryhtvdyfqvdpilggnealrhllevahahgvrvildgvfnhtgrgffafqhlmengeq spyrdwyhvkgfplkaytahpnyeawwgnpelpklkvetpavreyllavaehwirfgvdgwrldvpnei pdptfwrefrqrvkganpeayivgeiweeadfwlqgdmfdavmnyplaravlgfvggealdrdlaaqtg lgrieplqalafshrledlfgryrpevvraqmnlltshdtprllslmrgsverarlalallfllpgnpt vyygeevgmaggkdpenrggmvweearwqkdlretvkrlarlrkehpalrtapylriyaqdghlafarg pylavvnasphpfrqdfplhgvfprggravdllsgevctpqggrlcgpvlppfslalwrea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.236
    Matthews' coefficent 2.08 Rfactor 0.185
    Waters 781 Solvent Content 40.91

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch