.
The Open Protein Structure Annotation Network
PDB Keyword
.

2z1l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site RSGI
    PDB Id 2z1l Target Id mmt007119172.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13607, Molecular Weight 21257.47 Da.
    Residues 191 Isoelectric Point 6.16
    Sequence mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtagqedydrlrp lsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlrddpstieklaknkqkpit petaeklardlkavkyvecsaltqkglknvfdeailaaleppepkksrrcvll
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch