The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of GDP-D-Mannose Dehydratase from Aquifex aeolicus VF5. To be Published
    Site RSGI
    PDB Id 2z1m Target Id aae001001082.2
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12057, Molecular Weight 39336.17 Da.
    Residues 345 Isoelectric Point 5.44
    Sequence msgkralitgirgqdgaylaklllekgyevygadrrsgefaswrlkelgiendvkiihmdllefsniir tiekvqpdevynlaaqsfvgvsfeqpiltaevdaigvlrilealrtvkpdtkfyqastsemfgkvqeip qtektpfyprspyavaklfghwitvnyreaynmfacsgilfnhesplrgiefvtrkityslarikyglq dklvlgnlnakrdwgyapeyveamwlmmqqpepddyviatgethtvrefvekaakiagfdiewvgegin ekgidrntgkvivevseeffrpaevdilvgnpekamkklgwkprttfdelveimmeadlkrvrdrevsv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.233
    Matthews' coefficent 2.30 Rfactor 0.198
    Waters 516 Solvent Content 46.46

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch