.
The Open Protein Structure Annotation Network
PDB Keyword
.

2z1q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of acyl CoA dehydrogenase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2z1q Target Id ttk003000161.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS23806, Molecular Weight 63160.15 Da.
    Residues 577 Isoelectric Point 5.61
    Sequence mteekklwqkgggwllevpervytpedfdesvkeiarttrtfverevlpllermehgelelnvplmrka gelgllaidvpeeyggldlpkvistvvaeelsgsggfsvtygahtsigtlplvyfgteeqkrkylpkla sgewiaaycltepgsgsdalaaktratlsedgkhyilngvkqwisnagfahlftvfakvdgehftaflv erdtpglsfgpeekkmgikasstrqviledvkvpvenvlgeigkghkiafnvlnvgryklgagavggak ralelsaqyatqrvqfgrpigrfgliqqklgemasriyaaesavyrtvglideallgkkgpeavmagie eyaveasiikvlgsevldyvvdegvqihggygysqeypierayrdarinrifegtneinrllipgmllr ralkgqlplmqaaqrlqkellepsfeepedlelhqvqnlkklalmvaglavqkygqgveeeqevlgava dilidayaaesallrarrlgglapvlariylaqaldraqagalsvlprlvegdearvvysaarrltkre pvdlvalrrqaaeavleaggypipr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.269
    Matthews' coefficent 2.58 Rfactor 0.22
    Waters 454 Solvent Content 52.33

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch