The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized conserved protein from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2z3v Target Id ttk003001817.4
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14803, Molecular Weight 14756.15 Da.
    Residues 137 Isoelectric Point 5.27
    Sequence mfktillaydgseharraaevakaeaeahgarlivvhayepvpdylgepffeealrrrleraegvleea raltgvpkedalllegvpaeailqaaraekadlivmgtrglgalgslflgsqsqrvvaeapcpvllvr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.222
    Matthews' coefficent 2.62 Rfactor 0.193
    Waters 89 Solvent Content 52.97

    Ligand Information
    Ligands PGO (S-1,2-PROPANEDIOL) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch