The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A Common Mechanism for the ATP-DnaA-dependent Formation of Open Complexes at the Replication Origin. J.Biol.Chem. 283 8351-8362 2008
    Site RSGI
    PDB Id 2z4r Target Id trt001000473.1
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS14143, Molecular Weight 27492.19 Da.
    Residues 240 Isoelectric Point 5.62
    Sequence tplnpdytfenfvvgpgnsfayhaalevakhpgrynplfiyggvglgkthllqsignyvvqnepdlrvm yitsekflndlvdsmkegklnefrekyrkkvdilliddvqfligktgvqtelfhtfnelhdsgkqivic sdrepqklsefqdrlvsrfqmglvakleppdeetrksiarkmleiehgelpeevlnfvaenvddnlrrl rgaiikllvykettgkevdlkeailllkdfikp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 3.05 Rfree 0.264
    Matthews' coefficent 2.61 Rfactor 0.231
    Waters 4 Solvent Content 52.92

    Ligand Information
    Metals MG (MAGNESIUM) x 3



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch