.
The Open Protein Structure Annotation Network
PDB Keyword
.

2zad

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Muconate Cycloisomerase from Thermotoga maritima MSB8. To be Published
    Site RSGI
    PDB Id 2zad Target Id tma001000006.1
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS14070, Molecular Weight 38662.30 Da.
    Residues 345 Isoelectric Point 5.45
    Sequence msrivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerveallaiena vremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyllggkrdeietdktvgid tvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrgakyivdanmgytqkeavefaravyq kgidiavyeqpvrredieglkfvrfhspfpvaadesartkfdvmrlvkeeavdyvniklmksgisdala iveiaessglklmigcmgesslginqsvhfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.60 Rfree 0.20084
    Matthews' coefficent 2.49 Rfactor 0.17486
    Waters 1218 Solvent Content 50.57

    Ligand Information
    Ligands 1PE (PENTAETHYLENE) x 11;PEG (DI(HYDROXYETHYL)ETHER) x 4
    Metals MN (MANGANESE) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch