The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the short-isoform of the second WW domain from the human membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (MAGI-1). To be Published
    Site RSGI
    PDB Id 2zaj Target Id hso002002394.5
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13013, Molecular Weight 4295.52 Da.
    Residues 36 Isoelectric Point 4.33
    Sequence ldselelpagwekiedpvygiyyvdhinrktqyenp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch