The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of an N-terminally truncated selenophosphate synthetase from Aquifex aeolicus. Acta Crystallogr.,Sect.F 64 453-458 2008
    Site RSGI
    PDB Id 2zau Target Id aae001001030.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12051, Molecular Weight 34229.62 Da.
    Residues 311 Isoelectric Point 4.85
    Sequence mkgfniytdestlvsigddagvyehngiiwvytvdiitpvvndpylwgaistanalsdvyamggipvna laiscfnnceldieifrevirgaldklreaktvllgghtiddkepkfglsvagicpegkyitqsgaqvg qlliltkpigtgilikglkegilkeedineaienmlalndkarnlmlsldatactdvtgfgllghawni cknsnigariffekvpyyqlsenlvkkkiypkgaienlnfvknylksnldnwklillsdpvtsggllft inkeklekidetakelevnywiigetiaenvlevl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.00 Rfree 0.239
    Matthews' coefficent 3.14 Rfactor 0.212
    Waters 441 Solvent Content 60.80

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 3



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch