.
The Open Protein Structure Annotation Network
PDB Keyword
.

2zbt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of pyridoxine biosynthesis protein from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2zbt Target Id ttk003001575.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14748, Molecular Weight 32398.83 Da.
    Residues 297 Isoelectric Point 5.50
    Sequence meggmekgtfqiktgfaemfkggvimdvttpeqaviaeeagavavmalervpadiraqggvarmsdpki ikeimaavsipvmakvrighfveamileaigvdfidesevltpadeehhidkwkfkvpfvcgarnlgea lrriaegaamirtkgeagtgnvveavrhartmwkeiryvqslredelmayakeigapfelvkwvhdhgr lpvvnfaaggiatpadaalmmhlgmdgvfvgsgifksgdprkraraivravahyndpevlaevsedlge pmvginldqlkeeerlakrgw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.65 Rfree 0.21
    Matthews' coefficent 2.45 Rfactor 0.194
    Waters 622 Solvent Content 49.72

    Ligand Information
    Ligands MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch