.
The Open Protein Structure Annotation Network
PDB Keyword
.

2zbu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized conserved protein from Thermotoga maritima. To be Published
    Site RSGI
    PDB Id 2zbu Target Id tma001000660.1
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS14075, Molecular Weight 29197.04 Da.
    Residues 263 Isoelectric Point 5.35
    Sequence migfltdwglkshyvgvakavikrinpsaeiidithevepfnvrkashvlyrasldfppstvflvvvdy gvgtsrkaivmktkndqyfvapdngvltvvaeeygvaeireienrelfykknpsftfhgrdifapvaah ldmglplervgdrllsyevlkmrkpvvenekvigevaivdtfgnvstnipfdlflklsvdfddvvrvrv grkefkaavakafgdvdtgellvhpdsagfleiavnlgdasqvlsvkegdeieicr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.10 Rfree 0.257
    Matthews' coefficent 2.70 Rfactor 0.222
    Waters 290 Solvent Content 54.36

    Ligand Information
    Ligands ADN (ADENOSINE) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch