.
The Open Protein Structure Annotation Network
PDB Keyword
.

2zdc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of dUTPase from Sulfolobus tokodaii. To be Published
    Site RSGI
    PDB Id 2zdc Target Id sto001001632.2
    Molecular Characteristics
    Source Sulfolobus tokodaii
    Alias Ids TPS14055, Molecular Weight 18780.85 Da.
    Residues 167 Isoelectric Point 8.74
    Sequence mkglteklmilshqsiknllgkvilnyseenvrengydlricgdkyyelvqgaelpekkatlreiefke railsanhtylfesceefnmpadlavlitlkstlarngflapptvidagykgkvnvaitavynsslkkg mathhliflkldkpterlyngkyqggili
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.00 Rfree 0.256
    Matthews' coefficent 2.13 Rfactor 0.218
    Waters 59 Solvent Content 42.16

    Ligand Information
    Ligands SO4 (SULFATE) x 3;TRS (2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch