The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of D-Alanine:D-Alanine Ligase with ADP from Thermus thermophius HB8. To be Published
    Site RSGI
    PDB Id 2zdg Target Id ttk003001114.4
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14525, Molecular Weight 34664.07 Da.
    Residues 319 Isoelectric Point 4.97
    Sequence mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaapegehpfpppl swerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcmdkdlskrvlaqagvpvvpwvavrk geppvvpfdppffvkpantgssvgisrverfqdleaalalafrydekavvekalspvrelevgvlgnvf geaspvgevryeapfydyetkytpgraellipapldpgtqetvqelalkaykvlgvrgmarvdfflaeg elylnelntipgftptsmyprlfeaggvaypellrrlvelalt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.262
    Matthews' coefficent 2.48 Rfactor 0.214
    Waters 352 Solvent Content 50.50

    Ligand Information
    Metals MG (MAGNESIUM) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch