.
The Open Protein Structure Annotation Network
PDB Keyword
.

2zdh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of D-Alanine:D-Alanine Ligase with ADP and D-Alanine from Thermus thermophius HB8. To be Published
    Site RSGI
    PDB Id 2zdh Target Id ttk003001114.5
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14526, Molecular Weight 34664.07 Da.
    Residues 319 Isoelectric Point 4.97
    Sequence mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaapegehpfpppl swerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcmdkdlskrvlaqagvpvvpwvavrk geppvvpfdppffvkpantgssvgisrverfqdleaalalafrydekavvekalspvrelevgvlgnvf geaspvgevryeapfydyetkytpgraellipapldpgtqetvqelalkaykvlgvrgmarvdfflaeg elylnelntipgftptsmyprlfeaggvaypellrrlvelalt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.239
    Matthews' coefficent 2.61 Rfactor 0.207
    Waters 643 Solvent Content 52.95

    Ligand Information
    Ligands ADP (ADENOSINE-5'-DIPHOSPHATE) x 4;DAL (D-ALANINE) x 2
    Metals MG (MAGNESIUM) x 7

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch