The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of TTMA177, a Hypothetical Protein from Thermus thermophilus phage TMA. To be Published
    Site RSGI
    PDB Id 2zdj Target Id ar_001001060.1
    Molecular Characteristics
    Source Thermus thermophilus phage tma
    Alias Ids TPS12228, Molecular Weight 8079.73 Da.
    Residues 69 Isoelectric Point 4.46
    Sequence mkmrklvkdfgddytliqdsqevkaileyigseeephalfvkvgdgdyeevwgidsfvpynfleayrlk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.263
    Matthews' coefficent 2.22 Rfactor 0.21
    Waters 109 Solvent Content 44.60

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch