.
The Open Protein Structure Annotation Network
PDB Keyword
.

2zet

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases. Structure 16 1478-1490 2008
    Site RSGI
    PDB Id 2zet Target Id ar_001000757.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS22630, Molecular Weight 22783.65 Da.
    Residues 201 Isoelectric Point 5.16
    Sequence mtdgdydylikllalgdsgvgkttflyrytdnkfnpkfittvgidfrekrvvydtqgadgasgkafkvh lqlwdtaglerfrslttaffrdamgfllmfdltsqqsflnvrnwmsqlqanaycenpdivlignkadlp dqrevnerqarelaekygipyfetsaatgqnveksvetlldlimkrmekcvektqvpdtvngg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.00 Rfree 0.296
    Matthews' coefficent 3.36 Rfactor 0.247
    Waters 9 Solvent Content 63.36

    Ligand Information
    Ligands GTP (GUANOSINE-5'-TRIPHOSPHATE) x 2;SO4 (SULFATE) x 2
    Metals MG (MAGNESIUM) x 2;ZN (ZINC) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch