The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Hypothetical protein; probable 2-haloalkanoic acid dehalogenase from Sulfolobus tokodaii. To be Published
    Site RSGI
    PDB Id 2zg6 Target Id sto001002620.1
    Molecular Characteristics
    Source Sulfolobus tokodaii
    Alias Ids TPS14065, Molecular Weight 25456.02 Da.
    Residues 220 Isoelectric Point 5.63
    Sequence mkykavlvdfgntlvgfkpvfyekvyqvlkdngydldlrkvfrayakamgminypdedglehvdpkdfl yilgiypserlvkelkeadirdgeaflyddtlefleglksngyklalvsnasprvktllekfdlkkyfd alalsyeikavkpnpkifgfalakvgypavhvgdiyeldyigakrsyvdpilldrydfypdvrdrvknl realqkieemnke
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.24319
    Matthews' coefficent 4.34 Rfactor 0.21185
    Waters 74 Solvent Content 71.63

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch