.
The Open Protein Structure Annotation Network
PDB Keyword
.

2zgf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site RSGI
    PDB Id 2zgf Target Id ar_001000562.4
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12193, Molecular Weight 134270.14 Da.
    Residues 1210 Isoelectric Point 6.26
    Sequence mrpsgtagaallallaalcpasraleekkvcqgtsnkltqlgtfedhflslqrmfnncevvlgnleity vqrnydlsflktiqevagyvlialntveriplenlqiirgnmyyensyalavlsnydanktglkelpmr nlqeilhgavrfsnnpalcnvesiqwrdivssdflsnmsmdfqnhlgscqkcdpscpngscwgageenc qkltkiicaqqcsgrcrgkspsdcchnqcaagctgpresdclvcrkfrdeatckdtcpplmlynpttyq mdvnpegkysfgatcvkkcprnyvvtdhgscvracgadsyemeedgvrkckkcegpcrkvcngigigef kdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeldilktvkeitgflliqawpenr tdlhafenleiirgrtkqhgqfslavvslnitslglrslkeisdgdviisgnknlcyantinwkklfgt sgqktkiisnrgensckatgqvchalcspegcwgpeprdcvscrnvsrgrecvdkcnllegeprefven seciqchpeclpqamnitctgrgpdnciqcahyidgphcvktcpagvmgenntlvwkyadaghvchlch pnctygctgpglegcptngpkipsiatgmvgalllllvvalgiglfmrrrhivrkrtlrrllqerelve pltpsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankei ldeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvqiakgmnyl edrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpikwmalesilhriythqsdv wsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwmidadsrpkfrelii efskmardpqrylviqgdermhlpsptdsnfyralmdeedmddvvdadeylipqqgffsspstsrtpll sslsatsnnstvacidrnglqscpikedsflqryssdptgaltedsiddtflpvpeyinqsvpkrpags vqnpvyhnqplnpapsrdphyqdphstavgnpeylntvqptcvnstfdspahwaqkgshqisldnpdyq qdffpkeakpngifkgstaenaeylrvapqssefiga
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch