The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of putative 4-amino-4-deoxychorismate lyase from Thermus thermophilus HB8. Acta Crystallogr.,Sect.F 65 1234-1239 2009
    Site RSGI
    PDB Id 2zgi Target Id ttk003000196.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14270, Molecular Weight 27251.11 Da.
    Residues 246 Isoelectric Point 8.92
    Sequence mrllngtplalalpeaflyhgasvfttlraeggrplwleehlarlrrhalalglsypgdeafledleal lrafpkapclrlrftvgegvrlsearpyaplplslyregvrvrltgyrvhpdlaryktgnylpyrlale earkegafegllldafghvvdgsrtspllfregtlyllegglegitrekvaeaarglglrverglfrpe glrghlllagsgvgllpvrppppellplierflpacyte
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.93 Rfree 0.24927
    Matthews' coefficent 2.85 Rfactor 0.19327
    Waters 1318 Solvent Content 56.77

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch