.
The Open Protein Structure Annotation Network
PDB Keyword
.

2zgw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate. J.Biol.Chem. 283 14739-14750 2008
    Site RSGI
    PDB Id 2zgw Target Id pho001000147.21
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13778, Molecular Weight 25927.95 Da.
    Residues 235 Isoelectric Point 7.82
    Sequence mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgalnrkwespegglwlsivlspk vpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykaiagvlvegkgdkivlgiglnvnnkvpn gatsmklelgsevpllsvfrslitnldrlylnflknpmdilnlvrdnmilgvrvkilgdgsfegiaedi ddfgrliirldsgevkkviygdvslrfl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.204
    Matthews' coefficent 2.16 Rfactor 0.187
    Waters 584 Solvent Content 43.00

    Ligand Information
    Ligands ADN (ADENOSINE) x 2;BTN (BIOTIN) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch