.
The Open Protein Structure Annotation Network
PDB Keyword
.

2zio

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Multistep Engineering of Pyrrolysyl-tRNA Synthetase to Genetically Encode N(varepsilon)-(o-Azidobenzyloxycarbonyl) lysine for Site-Specific Protein Modification. Chem.Biol. 15 1187-1197 2008
    Site RSGI
    PDB Id 2zio Target Id trt001000322.6
    Molecular Characteristics
    Source Methanosarcina mazei
    Alias Ids TPS27342, Molecular Weight 31069.94 Da.
    Residues 270 Isoelectric Point 5.46
    Sequence asapaltksqtdrlevllnpkdeislnsgkpfrelesellsrrkkdlqqiyaeerenylgklereitrf fvdrgfleikspilipleyiermgidndtelskqifrvdknfclrpmlapnlynylrkldralpdpiki feigpcyrkesdgkehleeftmlnfcqmgsgctrenlesiitdflnhlgidfkivgdscmvygdtldvm hgdlelssavvgpipldrewgidkpwigagfglerllkvkhdfknikraarsesyyngistnl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.06 Rfree 0.213
    Matthews' coefficent 3.34 Rfactor 0.183
    Waters 152 Solvent Content 63.14

    Ligand Information
    Ligands 2PN (IMIDODIPHOSPHORIC) x 1;AYB (5'-O-[(S)-({(2S)-2-AMINO-6-[(PROPOXYCARBONYL)) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch