The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of PH0037 protein from Pyrococcus horikoshii. To be Published
    Site RSGI
    PDB Id 2zkt Target Id pho001000037.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13757, Molecular Weight 45417.59 Da.
    Residues 412 Isoelectric Point 5.95
    Sequence mvlkrkglliildglgdrpikelngltpleyantpnmdklaeigilgqqdpikpgqpagsdtahlsifg ydpyetyrgrgffealgvgldlskddlafrvnfatlengiitdrragristeeahelaraiqeevdigv dfifkgatghravlvlkgmsrgykvgdndpheagkpplkfsyededskkvaeileefvkkaqevlekhp inerrrkegkpianyllirgagtypnipmkfteqwkvkaagviavalvkgvaravgfdvytpegatgey ntnemakakkavellkdydfvflhfkptdaaghdnkpklkaelieradrmigyildhvdleevviaitg dhstpcevmnhsgdpvplliagggvrtddtkrfgereamkgglgrirghdivpimmdlmnrsekfga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.28556
    Matthews' coefficent 2.97 Rfactor 0.27705
    Waters 221 Solvent Content 58.55

    Ligand Information
    Metals ZN (ZINC) x 4;CA (CALCIUM) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch