.
The Open Protein Structure Annotation Network
PDB Keyword
.

2zkw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of human Cu-Zn superoxide dismutase mutant G85R in space group P21. To be Published
    Site RSGI
    PDB Id 2zkw Target Id ar_001000134.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12124, Molecular Weight 15902.86 Da.
    Residues 153 Isoelectric Point 5.87
    Sequence atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsagphfnplsr khggpkdeerhvgdlrnvtadkdgvadvsiedsvislsgdhciigrtlvvhekaddlgkggneestktg nagsrlacgvigiaq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.252
    Matthews' coefficent 1.80 Rfactor 0.193
    Waters 46 Solvent Content 31.54

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2;CU1 (COPPER) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch