The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of human Cu-Zn superoxide dismutase mutant G93A. To be Published
    Site RSGI
    PDB Id 2zky Target Id ar_001000133.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12122, Molecular Weight 15817.75 Da.
    Residues 153 Isoelectric Point 5.70
    Sequence atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsagphfnplsr khggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvhekaddlgkggneestktg nagsrlacgvigiaq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 10
    Resolution (Å) 2.40 Rfree 0.235
    Matthews' coefficent 3.73 Rfactor 0.189
    Waters 479 Solvent Content 67.06

    Ligand Information
    Metals ZN (ZINC) x 10



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch