.
The Open Protein Structure Annotation Network
PDB Keyword
.

2zm6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Thermus thermophilus 30S ribosomal subunit. To be Published
    Site RSGI
    PDB Id 2zm6 Target Id ttk003000838.6
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14456, Molecular Weight 29275.12 Da.
    Residues 256 Isoelectric Point 5.46
    Sequence mpveitvkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrggtil fvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspeieerpkkeqvrl khelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvialadtdsdpdlvdyiipgndda irsiqlilsravdliiqarggvvepspsyalvqeaeatetpegesevea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.30 Rfree 0.323
    Matthews' coefficent 4.80 Rfactor 0.292
    Waters Solvent Content 74.30

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch