.
The Open Protein Structure Annotation Network
PDB Keyword
.

2zod

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Selenophosphate Synthetase Essential for Selenium Incorporation into Proteins and RNAs. J.Mol.Biol. 2008
    Site RSGI
    PDB Id 2zod Target Id aae001001030.2
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12052, Molecular Weight 37658.38 Da.
    Residues 345 Isoelectric Point 4.96
    Sequence gsggiegrhmvellklvrssgcaakvgpgdlqeilkgfniytdestlvsigddagvyehngiiwvytvd iitpvvndpylwgaistanalsdvyamggipvnalaiscfnnceldieifrevirgaldklreaktvll gghtiddkepkfglsvagicpegkyitqsgaqvgqlliltkpigtgilikglkegilkeedineaienm lalndkarnlmlsldatactdvtgfgllghawnicknsnigariffekvpyyqlsenlvkkkiypkgai enlnfvknylksnldnwklillsdpvtsggllftinkeklekidetakelevnywiigetiaenvlevl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.98 Rfree 0.24
    Matthews' coefficent 1.99 Rfactor 0.204
    Waters 219 Solvent Content 38.28

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch