.
The Open Protein Structure Annotation Network
PDB Keyword
.

2zop

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of a CRISPR-associated RAMP superfamily protein, Cmr5, from Thermus thermophilus HB8. Proteins 75 528-532 2009
    Site RSGI
    PDB Id 2zop Target Id ttk003002135.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS23816, Molecular Weight 12960.17 Da.
    Residues 114 Isoelectric Point 9.34
    Sequence mrtrsqvwaqkayekvreaakgegrgeyrdmalklpvlvrqaglsqalafvdsrgkeahkalgndlaqv lgyrdlrelaeaareaellqylrltrevlaaaewfkrfaqaliee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.249
    Matthews' coefficent 2.29 Rfactor 0.235
    Waters 217 Solvent Content 46.40

    Ligand Information
    Ligands SO4 (SULFATE) x 7
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch