The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structual Basis of Iodo-Tyrosine Recognition by Engineered Archeal Tyrosyl-tRNA Synthetase. To be Published
    Site RSGI
    PDB Id 2zp1 Target Id ar_001000843.1
    Molecular Characteristics
    Source Methanocaldococcus jannaschii
    Alias Ids TPS12223, Molecular Weight 34988.90 Da.
    Residues 306 Isoelectric Point 6.64
    Sequence mdefemikrntseiiseeelrevlkkdeksayigfepsgkihlghylqikkmidlqnagfdiiilladl aaylnqkgeldeirkigdynkkvfeamglkakyvygsefqldkdytlnvyrlalkttlkrarrsmelia redenpkvaeviypimqvntshylgvdvavggmeqrkihmlarellpkkvvcihnpvltgldgegkmss skgnfiavddspeeirakikkaycpagvvegnpimeiakyfleypltikrpekfggdltvnsyeelesl fknkelhpmylknavaeelikilepirkrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.22
    Matthews' coefficent 2.60 Rfactor 0.193
    Waters 280 Solvent Content 52.68

    Ligand Information
    Ligands IYR (3-IODO-TYROSINE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch