.
The Open Protein Structure Annotation Network
PDB Keyword
.

2zqq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title AU-rich RNA-binding induces changes in the quaternary structure of AUH. Proteins 75 360-372 2009
    Site RSGI
    PDB Id 2zqq Target Id trt001000267.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS14128, Molecular Weight 28530.69 Da.
    Residues 266 Isoelectric Point 9.17
    Sequence edelrvrhleeenrgivvlginraygknslsknlikmlskavdalksdkkvrtiiirsevpgifcagad lkerakmsssevgpfvskiravindianlpvptiaaidglalggglelalacdirvaassakmglvetk laiipggggtqrlpraigmslakelifsarvldgkeakavglishvleqnqegdaayrkaldlareflp qgpvamrvaklainqgmevdlvtglaieeacyaqtiptkdrlegllafkekrpprykge
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.20 Rfree 0.246
    Matthews' coefficent 2.72 Rfactor 0.205
    Waters 508 Solvent Content 54.85

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch