.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ztg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Unique protein architecture of alanyl-tRNA synthetase for aminoacylation, editing, and dimerization. Proc.Natl.Acad.Sci.USA 106 8489-8494 2009
    Site RSGI
    PDB Id 2ztg Target Id ar_001000589.1
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS27319, Molecular Weight 83667.30 Da.
    Residues 739 Isoelectric Point 5.37
    Sequence mtldeeylditfltengfvrkrcpkcgkhfwtadpereicgdppcesysfignpvfkkpfeldemreyy lnfferrghgrierypvvarwrtdiyltiasiadfqpfvtsgvapppanpltisqpcirlddldsvgrt grhltlfemmahhafnypgkeiywknetvayctellnelgvkkedivykeepwagggnagpcleaivgg levatlvfmnleehpegdieikgaryrkmdnyivdtgyglerfvwaskgtptvydaifpevvdtiidns nvsfnredervrrivaessklagimgelrgerlnqlrksvadtvgvsveelegivvplekvysladhtr cilfmlgdglvpsnagagylarlmirrslrlaeelelgldlydlvemhkkilgfefdvplstvqeilel ekeryrttvskgtrlverlverkkklekddlielydshgipvelavgiaaekgaevempkdiyaelakr hskaekvqekkitlqneypateklyyddptllefeaevigvegdfvilnrsafypesggqdndvgylia nggkfevvdvleadgvvlhvvkgakpevgtkvkgvidsdvrwrhmrhhsathvllyslqkvlgnhvwqa garkefskarldvthfrrpseeeikeiemlanreilankpikwewmdrieaerkfgfrlyqggvppgrk irvvqvgddvqacggthcrstgeigmlkilkvesiqdgvirfefaagea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.264
    Matthews' coefficent 2.17 Rfactor 0.215
    Waters 152 Solvent Content 43.34

    Ligand Information
    Ligands A5A ('5'-O-(N-(L-ALANYL)-SULFAMOYL)ADENOSINE) x 1
    Metals ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch