.
The Open Protein Structure Annotation Network
PDB Keyword
.

2zul

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Thermus thermophilus 16S rRNA methyltransferase RsmC (TTHA0533) in complex with cofactor S-adenosyl-L-Methionine. To be Published
    Site RSGI
    PDB Id 2zul Target Id ttk003001444.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS24595, Molecular Weight 40653.73 Da.
    Residues 375 Isoelectric Point 9.16
    Sequence msltreayhrltplphpggrlfikpgargyrdpvhdllqktvepfgeraldlnpgvgwgslplegrmav erletsraafrcltasglqarlalpweaaagaydlvvlalpagrgtayvqaslvaaaralrmggrlyla gdknkgferyfkearallgygvvvrregpyrvallekekeapplpslwrafsarilgaeytfhhlpgvf sagkvdpasllllealqerlgpegvrgrqvldlgagygaltlplarmgaevvgveddlasvlslqkgle analkaqalhsdvdealteearfdiivtnppfhvggavildvaqafvnvaaarlrpggvfflvsnpflk yeplleekfgafqtlkvaeykvlfaekrgr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.217
    Matthews' coefficent 2.34 Rfactor 0.183
    Waters 296 Solvent Content 47.47

    Ligand Information
    Ligands SAM (S-ADENOSYLMETHIONINE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch