.
The Open Protein Structure Annotation Network
PDB Keyword
.

2zv2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of human calcium/calmodulin-dependent protein kinase kinase 2, beta, CaMKK2 kinase domain in complex with STO-609. To be Published
    Site RSGI
    PDB Id 2zv2 Target Id hsk002300769.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS27323, Molecular Weight 61469.86 Da.
    Residues 557 Isoelectric Point 6.38
    Sequence tmsscvssqpssnraapqdelggrgssssesqkpcealrglsslsihlgmesfivvtecepgcavdlgl ardrpleadgqevpldssgsqarphlsgrklslqersqgglaaggsldmngrcicpslpyspvsspqss prlprrptveshhvsitgmqdcvqlnqytlkdeigkgsygvvklaynendntyyamkvlskkklirqag fprrppprgtrpapggciqprgpieqvyqeiailkkldhpnvvklvevlddpnedhlymvfelvnqgpv mevptlkplsedqarfyfqdlikgieylhyqkiihrdikpsnllvgedghikiadfgvsnefkgsdall sntvgtpafmapeslsetrkifsgkaldvwamgvtlycfvfgqcpfmderimclhskiksqalefpdqp diaedlkdlitrmldknpesrivvpeiklhpwvtrhgaeplpsedenctlvevteeevensvkhipsla tvilvktmirkrsfgnpfegsrreerslsapgnlltkkptreceslselkgtkkkkgldsmtstvaagwldrrv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.252
    Matthews' coefficent 3.26 Rfactor 0.203
    Waters 53 Solvent Content 62.28

    Ligand Information
    Ligands 609 (7-OXO-7H-BENZIMIDAZO[2,1-A]BENZ[DE]ISOQUINOLINE-3-) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch