.
The Open Protein Structure Annotation Network
PDB Keyword
.

2zvf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Unique protein architecture of alanyl-tRNA synthetase for aminoacylation, editing, and dimerization. Proc.Natl.Acad.Sci.USA 106 8489-8494 2009
    Site RSGI
    PDB Id 2zvf Target Id ar_001000590.1
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS27321, Molecular Weight 19270.16 Da.
    Residues 171 Isoelectric Point 4.96
    Sequence mgeaaieaveemerllreassilrvepaklpktverffeewkdqrkeierlksviadlwadilmeraee fdsmkvvaevvdadmqalqklaerlaekgavgclmakgegkvfvvtfsgqkydarellreigrvakgsg ggrkdvaqgavqqlldreemldvifrflseheg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 3.20 Rfree 0.276
    Matthews' coefficent 3.61 Rfactor 0.205
    Waters 10 Solvent Content 65.96

    Ligand Information
    Ligands SO4 (SULFATE) x 6
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch