The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Thermus thermophilus 16S rRNA methyltransferase RsmC (TTHA0533). to be published
    Site RSGI
    PDB Id 2zwv Target Id ttk003001444.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS27346, Molecular Weight 40653.73 Da.
    Residues 375 Isoelectric Point 9.16
    Sequence msltreayhrltplphpggrlfikpgargyrdpvhdllqktvepfgeraldlnpgvgwgslplegrmav erletsraafrcltasglqarlalpweaaagaydlvvlalpagrgtayvqaslvaaaralrmggrlyla gdknkgferyfkearallgygvvvrregpyrvallekekeapplpslwrafsarilgaeytfhhlpgvf sagkvdpasllllealqerlgpegvrgrqvldlgagygaltlplarmgaevvgveddlasvlslqkgle analkaqalhsdvdealteearfdiivtnppfhvggavildvaqafvnvaaarlrpggvfflvsnpflk yeplleekfgafqtlkvaeykvlfaekrgr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.225
    Matthews' coefficent 2.31 Rfactor 0.189
    Waters 238 Solvent Content 46.81

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch