.
The Open Protein Structure Annotation Network
PDB Keyword
.

2zxv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Genetic Encoding of 3-Iodo-l-Tyrosine in Escherichia coli for Single-Wavelength Anomalous Dispersion Phasing in Protein Crystallography. Structure 17 335-344 2009
    Site RSGI
    PDB Id 2zxv Target Id ttk003001865.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS27348, Molecular Weight 22027.25 Da.
    Residues 193 Isoelectric Point 9.59
    Sequence mwafperfegrhvrleplalahlpaflrhydpevyrflsrapvapteealrahlegllgepgrvnwail fgkevagrisviapepehaklelgtmlfkpfwgspankeakylllrhafevlraervqfkvdlrnersq ralealgavregvlrknrrlpdgafrddvvysvlkeewpgvkarlearlygasgn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.266
    Matthews' coefficent 2.80 Rfactor 0.228
    Waters 176 Solvent Content 56.01

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch