.
The Open Protein Structure Annotation Network
PDB Keyword
.

2zzn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Tertiary structure checkpoint at anticodon loop modification in tRNA functional maturation. Nat.Struct.Mol.Biol. 16 1109-1115 2009
    Site RSGI
    PDB Id 2zzn Target Id ar_001000741.3
    Molecular Characteristics
    Source Methanocaldococcus jannaschii
    Alias Ids TPS31849, Molecular Weight 38997.80 Da.
    Residues 336 Isoelectric Point 9.13
    Sequence mplclkinkkhgeqtrriliennllnkdykitsegnylylpikdvdedilksilniefelvdkeleekk iikkpsfreiiskkyrkeideglislsydvvgdlvilqisdevdekirkeigelayklipckgvfrrks evkgefrvrelehlagenrtltihkengyrlwvdiakvyfsprlggerarimkkvslndvvvdmfagvg pfsiacknakkiyaidinphaiellkkniklnklehkiipilsdvrevdvkgnrvimnlpkfahkfidk aldiveeggvihyytigkdfdkaiklfekkcdcevlekrivksyapreyilaldfkinkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.95 Rfree 0.295
    Matthews' coefficent 2.32 Rfactor 0.226
    Waters 25 Solvent Content 46.95

    Ligand Information
    Ligands SAM (S-ADENOSYLMETHIONINE) x 2
    Metals MG (MAGNESIUM) x 7

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch