.
The Open Protein Structure Annotation Network
PDB Keyword
.

3a4t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Methanocaldococcus jannaschii Trm4 complexed with sinefungin. J.Mol.Biol. 2010
    Site RSGI
    PDB Id 3a4t Target Id mja001000026.2
    Molecular Characteristics
    Source Methanocaldococcus jannaschii
    Alias Ids TPS31850, Molecular Weight 31488.43 Da.
    Residues 274 Isoelectric Point 9.09
    Sequence mmivykgekmqfirvntlkinpevlkkrlenkgvvlektfldyafevkkspfsigstpeylfgyympqs issmippivlnpreddfildmcaapggktthlaqlmknkgtivaveisktrtkalksninrmgvlntii inadmrkykdyllkneiffdkilldapcsgniikdknrnvseedikycslrqkelidigidllkkdgel vystcsmeveeneevikyilqkrndveliiikanefkginikegyikgtlrvfppnepffiaklrki
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.26756
    Matthews' coefficent 2.17 Rfactor 0.18116
    Waters 167 Solvent Content 43.41

    Ligand Information
    Ligands SFG (ADENOSYL-ORNITHINE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch