.
The Open Protein Structure Annotation Network
PDB Keyword
.

3a5y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A paralog of lysyl-tRNA synthetase aminoacylates a conserved lysine residue in translation elongation factor P. Nat.Struct.Mol.Biol. 2010
    Site RSGI
    PDB Id 3a5y Target Id my_001000087.1
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS13743, Molecular Weight 36974.11 Da.
    Residues 325 Isoelectric Point 5.08
    Sequence msetaswqpsasipnllkraaimaeirrffadrgvlevetpcmsqatvtdihlvpfetrfvgpghsqgm nlwlmtspeyhmkrllvagcgpvfqlcrsfrneemgryhnpeftmlewyrphydmyrlmnevddllqqv ldcpaaeslsyqqaflryleidplsadktqlrevaakldlsnvadteedrdtllqllftfgvepnigke kptfvyhfpasqaslaqistedhrvaerfevyykgielangfheltdareqqqrfeqdnrkraarglpq hpidqnliealkvgmpdcsgvalgvdrlvmlalgaetlaeviafsvdra
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.219
    Matthews' coefficent 2.17 Rfactor 0.171
    Waters 1031 Solvent Content 43.30

    Ligand Information
    Ligands KAA (5'-O-[(L-LYSYLAMINO)SULFONYL]ADENOSINE) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch