.
The Open Protein Structure Annotation Network
PDB Keyword
.

3boy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of HutP complexed with the 55-mer RNA. To be Published
    Site RSGI
    PDB Id 3boy Target Id ar_001000707.1
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS12211, Molecular Weight 16063.49 Da.
    Residues 147 Isoelectric Point 5.96
    Sequence tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkvvaaietaskksgviqsegyr eshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwiavslygtigapikglehe tfgvginhi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.70 Rfree 0.24629
    Matthews' coefficent 2.05 Rfactor 0.19757
    Waters 406 Solvent Content 39.96

    Ligand Information
    Ligands HIS x 3
    Metals MG (MAGNESIUM) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch