.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cm0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of adenylate kinase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 3cm0 Target Id ttk003000089.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14223, Molecular Weight 20752.63 Da.
    Residues 186 Isoelectric Point 5.20
    Sequence mdvgqaviflgppgagkgtqasrlaqelgfkklstgdilrdhvargtplgervrpimergdlvpddlil elireelaervifdgfprtlaqaealdrllsetgtrllgvvlvevpeeelvrrilrraelegrsddnee tvrrrlevyrekteplvgyyeargvlkrvdglgtpdevyariraalgi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.242
    Matthews' coefficent 2.42 Rfactor 0.205
    Waters 88 Solvent Content 49.10

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch