.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gh7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Molecular Cloning and Crystal Structural Analysis of a Novel beta-N-Acetylhexosaminidase from Paenibacillus sp. TS12 Capable of Degrading Glycosphingolipids. J.Mol.Biol. 2009
    Site RSGI
    PDB Id 3gh7 Target Id my_001000188.3
    Molecular Characteristics
    Source Paenibacillus sp.
    Alias Ids TPS31859, Molecular Weight 55051.80 Da.
    Residues 502 Isoelectric Point 5.25
    Sequence mmsfipesasastsqpsilpkpvsytvgsgqfvltknasifvagnnvgetdelfnigqalakklnastg ytisvvksnqptagsiylttvggnaalgnegydlittsnqvtltankpegvfrgnqtllqllpagiekn tvvsgvqwviphsnisdkpeyeyrglmldvarhfftvdevkrqidlasqykinkfhmhlsddqgwriei kswpdlieigskgqvgggpggyytqeqfkdivsyaaeryievipeidmpghtnaalasygelnpdgkrk amrtdtavgystlmpraeityqfvedviselaaispspyihlggdesnatsaadydyffgrvtaiansy gkkvvgwdpsdtssgatsdsvlqnwtcsastgtaakakgmkvivspanayldmkyysdspiglqwrgfv ntnraynwdptdcikganiygvestlwtetfvtqdhldymlypkllsnaevgwtargdrnwddfkerli ehtprlqnkgikffadpiv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.18004
    Matthews' coefficent 2.29 Rfactor 0.13978
    Waters 562 Solvent Content 46.35

    Ligand Information
    Ligands SO4 (SULFATE) x 1;NGA (N-ACETYL-D-GALACTOSAMINE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch