.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hpd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Hydroxyethylthiazole Kinase Protein from Pyrococcus Horikoshii Ot3. To be Published
    Site RSGI
    PDB Id 3hpd Target Id pho001001157.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13977, Molecular Weight 28952.74 Da.
    Residues 265 Isoelectric Point 6.17
    Sequence mkfiiealkrvrerrplvhnitnfvvmnttanallalgaspvmahaeeeleemirladavvinigtlds gwrrsmvkateianelgkpivldpvgagatkfrtrvsleilsrgvdvlkgnfgeisallgeegktrgvd sleygeeeakkltmnaarefnttvavtgavdyvsdgrrtfavynghellgrvtgtgcmvaaltgafvav teplkattsalvtfgiaaekayeeakypgsfhvklydwlyrinenvirtyakvrevel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.184
    Matthews' coefficent 2.03 Rfactor 0.164
    Waters 208 Solvent Content 39.48

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch