.
The Open Protein Structure Annotation Network
PDB Keyword
.

3i7u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Free and ATP-bound structures of Ap(4)A hydrolase from Aquifex aeolicus V5. Acta Crystallogr.,Sect.D 66 116-124 2010
    Site RSGI
    PDB Id 3i7u Target Id aae001000158.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12025, Molecular Weight 15755.67 Da.
    Residues 134 Isoelectric Point 9.16
    Sequence mkkefsaggvlfkdgevlliktpsnvwsfpkgniepgekpeetavrevweetgvkgeildyigeihywy tlkgerifktvkyylmkykegeprpswevkdakffpikeakkllkykgdkeifekalklkekfkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.80 Rfree 0.239
    Matthews' coefficent 2.26 Rfactor 0.203
    Waters 558 Solvent Content 45.47

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 11;PEG (DI(HYDROXYETHYL)ETHER) x 4;TRS (2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL) x 1;PGE (TRIETHYLENE) x 2;PG4 (TETRAETHYLENE) x 1
    Metals CL (CHLORIDE) x 11

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch