.
The Open Protein Structure Annotation Network
PDB Keyword
.

3iwt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of hypothetical Mo-cofactor biosynthesis protein B (ST2315) from Sulfolobus tokodaii. Acta Crystallogr.,Sect.F 65 1200-1203 2009
    Site RSGI
    PDB Id 3iwt Target Id sto001002315.1
    Molecular Characteristics
    Source Sulfolobus tokodaii
    Alias Ids TPS14061, Molecular Weight 19706.81 Da.
    Residues 178 Isoelectric Point 6.98
    Sequence mshahkkhkenapkslnfyvitistsryekllkkepivdesgdiikqllienghkiigyslvpddkiki lkaftdalsidevdviistggtgysptditvetirklfdreiegfsdvfrlvsfndpevkaaayltkas agiigkkivyllpgspdavklalkelilpevghlvylvrs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.90 Rfree 0.18695
    Matthews' coefficent 4.79 Rfactor 0.16841
    Waters 582 Solvent Content 74.34

    Ligand Information
    Ligands PEG (DI(HYDROXYETHYL)ETHER) x 8;GOL (GLYCEROL) x 2
    Metals MG (MAGNESIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch