.
The Open Protein Structure Annotation Network
PDB Keyword
.

1dbx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of YbaK protein from Haemophilus influenzae (HI1434) at 1.8 A resolution: functional implications. Proteins 40 86-97 2000
    Site S2F
    PDB Id 1dbx Target Id HI1434
    Related PDB Ids 1dbu 
    Molecular Characteristics
    Source
    Alias Ids TPS14847, Molecular Weight 17167.96 Da.
    Residues 158 Isoelectric Point 8.87
    Sequence mtpaidllkkqkipfilhtydhdpnnqhfgdeaaeklgidpnrsfktllvaengdqkklacfvlatanm lnlkkaaksigvkkvemadkdaaqkstgylvggisplgqkkrvktvikstalefetiyvsggkrglsve iapqdlakvlgaeftdivde
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.259
    Matthews' coefficent 2.00 Rfactor 0.183
    Waters 374 Solvent Content 28.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch