.
The Open Protein Structure Annotation Network
PDB Keyword
.

1htw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the YjeE protein from Haemophilus influenzae: a putative Atpase involved in cell wall synthesis. Proteins 48 220-226 2002
    Site S2F
    PDB Id 1htw Target Id HI0065
    Related PDB Ids 1fl9 
    Molecular Characteristics
    Source
    Alias Ids TPS14845, Molecular Weight 17968.58 Da.
    Residues 158 Isoelectric Point 4.74
    Sequence mesltqyipdefsmlrfgkkfaeillklhtekaimvylngdlgagkttltrgmlqgighqgnvksptyt lveeyniagkmiyhfdlyrladpeelefmgirdyfntdsicliewsekgqgilpeadilvnidyyddar nieliaqtnlgkniisafsn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.70 Rfree 0.2350000
    Matthews' coefficent 2.31 Rfactor 0.1990000
    Waters 407 Solvent Content 46.67

    Ligand Information
    Ligands ACT (ACETATE) x 1;ADP (ADENOSINE-5'-DIPHOSPHATE) x 3
    Metals MG (MAGNESIUM) x 4;NA (SODIUM) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch