.
The Open Protein Structure Annotation Network
PDB Keyword
.

1izm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of HI0817 from Haemophilus influenzae: protein of unknown function with a novel fold. Proteins 57 874-877 2004
    Site S2F
    PDB Id 1izm Target Id HI0817
    Molecular Characteristics
    Source
    Alias Ids TPS14865, Molecular Weight 20289.35 Da.
    Residues 182 Isoelectric Point 3.96
    Sequence mlishsdlnqqlksagigfnatelhgflsgllcgglkdqswlpllyqfsndnhayptglvqpvtelyeq isqtlsdvegftfelgltedenvftqadslsdwanqfllgiglaqpelakekgeigeavddlqdicqlg ydeddneeelaealeeiieyvrtiamlfyshfnegeieskpvlh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.255
    Matthews' coefficent 2.15 Rfactor 0.194
    Waters 201 Solvent Content 42.92

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch